Lineage for d6cawb1 (6caw B:36-440)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720725Species Burkholderia pseudomallei [TaxId:320372] [350085] (5 PDB entries)
  8. 2720744Domain d6cawb1: 6caw B:36-440 [350546]
    automated match to d2ccda1
    complexed with hem, mpd, na, oxy, po4

Details for d6cawb1

PDB Entry: 6caw (more details), 1.95 Å

PDB Description: crystal structure of the w95f variant of catalase-peroxidase from b. pseudomallei
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d6cawb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cawb1 a.93.1.0 (B:36-440) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdwf
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d6cawb1:

Click to download the PDB-style file with coordinates for d6cawb1.
(The format of our PDB-style files is described here.)

Timeline for d6cawb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cawb2