SCOPe 2.08: Domain d6caua2: 6cau A:111-328

Lineage for d6caua2 (6cau A:111-328)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.0: automated matches [254328] (1 protein)
   not a true family

6. Protein automated matches [254749] (4 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [350527] (1 PDB entry)

8. Domain d6caua2: 6cau A:111-328 [350528]
   Other proteins in same PDB: d6caua1, d6caua3
   automated match to d1p3da3
   complexed with anp, mg

Details for d6caua2

PDB Entry: 6cau, 2.5 Å

PDB Description: udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp

PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6caua2:

Sequence, based on SEQRES records:

>d6caua2 c.72.2.0 (A:111-328) automated matches {Acinetobacter baumannii [TaxId: 470]}
raemlgelmryrhgiavagthgkttttsllttmlaeenldptyviggllnstgvnaalge
srfivaeadesdasflylqpmaaivtnidadhmdtyegsfdklkdtfvqflhnlpfygla
vvcgddanireilprvgrpvitygfnedndiraidveqdgmrshftvlrkgreplrltin
qpglhnvlnalaaigvatdegvsdeaisralkgfsgvg

Sequence, based on observed residues (ATOM records):

>d6caua2 c.72.2.0 (A:111-328) automated matches {Acinetobacter baumannii [TaxId: 470]}
raemlgelmryrhgiavagthgkttttsllttmlaeenldptyviggllnstgvnaalge
srfivaeadesdasflylqpmaaivtnidadgsfdklkdtfvqflhnlpfyglavvcgdd
anireilprvgrpvitygfnedndiraidveqdgmrshftvlrkgreplrltinqpglhn
vlnalaaigvatdegvsdeaisralkgfsgvg

Timeline for d6caua2:

• d6caua2 first appeared in SCOPe 2.07