Lineage for d6caua2 (6cau A:111-328)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2478216Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2478789Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2478847Family c.72.2.0: automated matches [254328] (1 protein)
    not a true family
  6. 2478848Protein automated matches [254749] (4 species)
    not a true protein
  7. 3050465Species Acinetobacter baumannii [TaxId:470] [350527] (1 PDB entry)
  8. 3050466Domain d6caua2: 6cau A:111-328 [350528]
    Other proteins in same PDB: d6caua1, d6caua3
    automated match to d1p3da3
    complexed with anp, mg

Details for d6caua2

PDB Entry: 6cau (more details), 2.5 Å

PDB Description: udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp
PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6caua2:

Sequence, based on SEQRES records: (download)

>d6caua2 c.72.2.0 (A:111-328) automated matches {Acinetobacter baumannii [TaxId: 470]}
raemlgelmryrhgiavagthgkttttsllttmlaeenldptyviggllnstgvnaalge
srfivaeadesdasflylqpmaaivtnidadhmdtyegsfdklkdtfvqflhnlpfygla
vvcgddanireilprvgrpvitygfnedndiraidveqdgmrshftvlrkgreplrltin
qpglhnvlnalaaigvatdegvsdeaisralkgfsgvg

Sequence, based on observed residues (ATOM records): (download)

>d6caua2 c.72.2.0 (A:111-328) automated matches {Acinetobacter baumannii [TaxId: 470]}
raemlgelmryrhgiavagthgkttttsllttmlaeenldptyviggllnstgvnaalge
srfivaeadesdasflylqpmaaivtnidadgsfdklkdtfvqflhnlpfyglavvcgdd
anireilprvgrpvitygfnedndiraidveqdgmrshftvlrkgreplrltinqpglhn
vlnalaaigvatdegvsdeaisralkgfsgvg

SCOPe Domain Coordinates for d6caua2:

Click to download the PDB-style file with coordinates for d6caua2.
(The format of our PDB-style files is described here.)

Timeline for d6caua2:

  • d6caua2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08