Lineage for d6caua1 (6cau A:19-110)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2433922Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 2433923Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) (S)
  5. 2433946Family c.5.1.0: automated matches [254240] (1 protein)
    not a true family
  6. 2433947Protein automated matches [254548] (7 species)
    not a true protein
  7. 3050463Species Acinetobacter baumannii [TaxId:470] [350525] (1 PDB entry)
  8. 3050464Domain d6caua1: 6cau A:19-110 [350526]
    Other proteins in same PDB: d6caua2, d6caua3
    automated match to d1gqqa1
    complexed with anp, mg

Details for d6caua1

PDB Entry: 6cau (more details), 2.5 Å

PDB Description: udp-n-acetylmuramate--alanine ligase from acinetobacter baumannii ab5075-uw with amppnp
PDB Compounds: (A:) UDP-N-acetylmuramate--L-alanine ligase

SCOPe Domain Sequences for d6caua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6caua1 c.5.1.0 (A:19-110) automated matches {Acinetobacter baumannii [TaxId: 470]}
mrrikhihfvgiggagmcgiaevlanqgykisgsdikaskttqqleengikvyigheaen
iknanvlvvstaidpenpevkaaieqripivr

SCOPe Domain Coordinates for d6caua1:

Click to download the PDB-style file with coordinates for d6caua1.
(The format of our PDB-style files is described here.)

Timeline for d6caua1:

  • d6caua1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08