Lineage for d6f47a1 (6f47 A:2-413)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530187Species Clostridium botulinum [TaxId:1491] [193827] (7 PDB entries)
  8. 3050461Domain d6f47a1: 6f47 A:2-413 [350523]
    Other proteins in same PDB: d6f47a2
    automated match to d2etfa_
    complexed with zn

Details for d6f47a1

PDB Entry: 6f47 (more details), 1.35 Å

PDB Description: crystal structure of the catalytic domain of botulinum neurotoxin x
PDB Compounds: (A:) Catalytic domain of botulinum neurotoxin X

SCOPe Domain Sequences for d6f47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f47a1 d.92.1.0 (A:2-413) automated matches {Clostridium botulinum [TaxId: 1491]}
kleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvikniwivperynftnntn
dlnipsepimeadaiynpnylntpsekdeflqgvikvlerikskpegekllelisssipl
plvsngaltlsdnetiayqennnivsnlqanlviygpgpdiannatyglystpisngegt
lsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpastlmhelvhvthnlygisn
rnfyynfdtgkietsrqqnslifeelltfggidskaissliikkiietaknnyttliser
lntvtvendllkyiknkipvqgrlgnfkldtaefekklntilfvlnesnlaqrfsilvrk
hylkerpidpiyvnilddnsystlegfnissqgsndfqgqllessyfekies

SCOPe Domain Coordinates for d6f47a1:

Click to download the PDB-style file with coordinates for d6f47a1.
(The format of our PDB-style files is described here.)

Timeline for d6f47a1:

  • d6f47a1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f47a2