Lineage for d6f0ea2 (6f0e A:97-303)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435567Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2435568Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2435569Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. 2435587Protein automated matches [233926] (3 species)
    not a true protein
  7. 3050434Species Saccharomyces cerevisiae [TaxId:559292] [350496] (1 PDB entry)
  8. 3050435Domain d6f0ea2: 6f0e A:97-303 [350497]
    Other proteins in same PDB: d6f0ea1
    automated match to d1auaa2
    complexed with c8k

Details for d6f0ea2

PDB Entry: 6f0e (more details), 2.6 Å

PDB Description: structure of yeast sec14p with a picolinamide compound
PDB Compounds: (A:) SEC14 cytosolic factor

SCOPe Domain Sequences for d6f0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f0ea2 c.13.1.1 (A:97-303) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
ydekpliakfypqyyhktdkdgrpvyfeelgavnlhemnkvtseermlknlvweyesvvq
yrlpacsraaghlvetsctimdlkgisissaysvmsyvreasyisqnyypermgkfyiin
apfgfstafrlfkpfldpvtvskifilgssyqkellkqipaenlpvkfggksevdeskgg
lylsdigpwrdpkyigpegeapeafsm

SCOPe Domain Coordinates for d6f0ea2:

Click to download the PDB-style file with coordinates for d6f0ea2.
(The format of our PDB-style files is described here.)

Timeline for d6f0ea2:

  • d6f0ea2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f0ea1