Lineage for d6f0ea1 (6f0e A:4-96)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308558Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 2308577Family a.5.3.0: automated matches [227224] (1 protein)
    not a true family
  6. 2308578Protein automated matches [226965] (4 species)
    not a true protein
  7. 3050432Species Saccharomyces cerevisiae [TaxId:559292] [350494] (1 PDB entry)
  8. 3050433Domain d6f0ea1: 6f0e A:4-96 [350495]
    Other proteins in same PDB: d6f0ea2
    automated match to d1auaa1
    complexed with c8k

Details for d6f0ea1

PDB Entry: 6f0e (more details), 2.6 Å

PDB Description: structure of yeast sec14p with a picolinamide compound
PDB Compounds: (A:) SEC14 cytosolic factor

SCOPe Domain Sequences for d6f0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f0ea1 a.5.3.0 (A:4-96) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
qqekeflesypqncppdalpgtpgnldsaqekalaelrklledagfierlddstllrflr
arkfdvqlakemfencekwrkdygtdtilqdfh

SCOPe Domain Coordinates for d6f0ea1:

Click to download the PDB-style file with coordinates for d6f0ea1.
(The format of our PDB-style files is described here.)

Timeline for d6f0ea1:

  • d6f0ea1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f0ea2