Lineage for d6cafa_ (6caf A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418280Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2418514Protein automated matches [190666] (3 species)
    not a true protein
  7. 3050417Species Canavalia ensiformis [TaxId:3823] [350479] (1 PDB entry)
  8. 3050418Domain d6cafa_: 6caf A: [350480]
    automated match to d1cnva_

Details for d6cafa_

PDB Entry: 6caf (more details), 1.3 Å

PDB Description: high resolution structure of concanavalin b from jack bean (canavalia ensiformis), a chitinase-like protein
PDB Compounds: (A:) concanavalin b

SCOPe Domain Sequences for d6cafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cafa_ c.1.8.5 (A:) automated matches {Canavalia ensiformis [TaxId: 3823]}
dissteiavywgqredgllrdtcktnnykivfisfldkfgceirkpelelegvcgpsvgn
pcsflesqikecqrmgvkvflalggpkgtysacsadyakdlaeylhtyflserregplgk
valdgihfdiqkpvdelnwdnlleelyqikdvyqstfllsaapgclspdeyldnaiqtrh
fdyifvrfyndrscqystgniqrirnawlswtksvyprdknlflelpasqatapgggyip
psaligqvlpylpdlqtryagialwnrqadketgystniirylnatam

SCOPe Domain Coordinates for d6cafa_:

Click to download the PDB-style file with coordinates for d6cafa_.
(The format of our PDB-style files is described here.)

Timeline for d6cafa_:

  • d6cafa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08