Lineage for d6f3fa2 (6f3f A:146-248)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 protein domains)
    Pfam PF00017
  6. 2530479Protein c-src tyrosine kinase [55556] (4 species)
  7. 3050408Species Mus musculus [TaxId:10090] [350470] (1 PDB entry)
  8. 3050409Domain d6f3fa2: 6f3f A:146-248 [350471]
    Other proteins in same PDB: d6f3fa1, d6f3fa3, d6f3fa4
    automated match to d1fmka2
    complexed with adp, mg

Details for d6f3fa2

PDB Entry: 6f3f (more details), 2.42 Å

PDB Description: autoinhibited src kinase bound to adp
PDB Compounds: (A:) Tyrosine-protein kinase

SCOPe Domain Sequences for d6f3fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f3fa2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Mus musculus [TaxId: 10090]}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOPe Domain Coordinates for d6f3fa2:

Click to download the PDB-style file with coordinates for d6f3fa2.
(The format of our PDB-style files is described here.)

Timeline for d6f3fa2:

  • d6f3fa2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08