Lineage for d6f0oa2 (6f0o A:1089-1291)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385683Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2385726Protein automated matches [229100] (5 species)
    not a true protein
  7. 3050391Species Clostridium botulinum [TaxId:498214] [350453] (1 PDB entry)
  8. 3050392Domain d6f0oa2: 6f0o A:1089-1291 [350454]
    Other proteins in same PDB: d6f0oa1
    automated match to d5jlva2
    complexed with 1pe, edo, ppi

Details for d6f0oa2

PDB Entry: 6f0o (more details), 1.6 Å

PDB Description: botulinum neurotoxin a3 hc domain
PDB Compounds: (A:) Bontoxilysin A

SCOPe Domain Sequences for d6f0oa2:

Sequence, based on SEQRES records: (download)

>d6f0oa2 b.42.4.2 (A:1089-1291) automated matches {Clostridium botulinum [TaxId: 498214]}
npgilkdfwgnylqydkpyymlnlfdpnkyvdvnnigirgymylkgprgsvmttniylns
tlymgtkfiikkyasgnednivrnndrvyinvvvknkeyrlatnasqagvekilsaleip
dvgnlsqvvvmkskddqgirnkckmnlqdnngndigfvgfhlydniaklvasnwynrqvg
kasrtfgcswefipvddgwgess

Sequence, based on observed residues (ATOM records): (download)

>d6f0oa2 b.42.4.2 (A:1089-1291) automated matches {Clostridium botulinum [TaxId: 498214]}
npgilkdfwgnylqydkpyymlnlfdpnkyvdvnnigirgymylkgprgsvmttniylns
tlymgtkfiikkyasgnednivrnndrvyinvvvknkeyrlatnasgvekilsaleipdv
gnlsqvvvmkskdirnkckmnlqdnngndigfvgfhlydniaklvasnwyntfgcswefi
pvddgwgess

SCOPe Domain Coordinates for d6f0oa2:

Click to download the PDB-style file with coordinates for d6f0oa2.
(The format of our PDB-style files is described here.)

Timeline for d6f0oa2:

  • d6f0oa2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f0oa1