Lineage for d6coaa_ (6coa A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372691Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2372692Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2372693Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 protein domains)
    automatically mapped to Pfam PF00314
  6. 2372701Protein Thaumatin [49876] (1 species)
  7. 2372702Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (98 PDB entries)
    Uniprot P02883
  8. 3050377Domain d6coaa_: 6coa A: [350439]
    automated match to d1kwna_
    complexed with tla

Details for d6coaa_

PDB Entry: 6coa (more details), 1.2 Å

PDB Description: 1.2 a structure of thaumatin crystallized in gel
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d6coaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6coaa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

SCOPe Domain Coordinates for d6coaa_:

Click to download the PDB-style file with coordinates for d6coaa_.
(The format of our PDB-style files is described here.)

Timeline for d6coaa_:

  • d6coaa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08