Lineage for d6f2ua_ (6f2u A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2415942Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2416179Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2416180Species Human (Homo sapiens) [TaxId:9606] [102052] (45 PDB entries)
    Uniprot P42330
  8. 3050375Domain d6f2ua_: 6f2u A: [350437]
    automated match to d3uwea_
    complexed with cj2, nap

Details for d6f2ua_

PDB Entry: 6f2u (more details), 1.88 Å

PDB Description: potent and selective aldo-keto reductase 1c3 (akr1c3) inhibitors based on the benzoisoxazole moiety: application of a bioisosteric scaffold hopping approach to flufenamic acid
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d6f2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f2ua_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypy

SCOPe Domain Coordinates for d6f2ua_:

Click to download the PDB-style file with coordinates for d6f2ua_.
(The format of our PDB-style files is described here.)

Timeline for d6f2ua_:

  • d6f2ua_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08