Lineage for d6cf5d1 (6cf5 D:1-174)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (23 species)
    not a true protein
  7. 3050101Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [350163] (1 PDB entry)
  8. 3050372Domain d6cf5d1: 6cf5 D:1-174 [350434]
    Other proteins in same PDB: d6cf5a1, d6cf5a2, d6cf5b2, d6cf5c1, d6cf5c2, d6cf5d2, d6cf5e1, d6cf5e2, d6cf5f2
    automated match to d3m5jb_
    complexed with gol, nag, nhe, peg

Details for d6cf5d1

PDB Entry: 6cf5 (more details), 2.04 Å

PDB Description: crystal structure of the a/viet nam/1203/2004(h5n1) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6cf5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cf5d1 h.3.1.0 (D:1-174) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeis

SCOPe Domain Coordinates for d6cf5d1:

Click to download the PDB-style file with coordinates for d6cf5d1.
(The format of our PDB-style files is described here.)

Timeline for d6cf5d1:

  • d6cf5d1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08