Lineage for d6ezfa1 (6ezf A:580-919)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (116 PDB entries)
  8. 3050369Domain d6ezfa1: 6ezf A:580-919 [350431]
    Other proteins in same PDB: d6ezfa2
    automated match to d5vp0b_
    complexed with c6z, gol, mg, na, so4, zn

Details for d6ezfa1

PDB Entry: 6ezf (more details), 1.5 Å

PDB Description: pde2 in complex with molecule 5
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6ezfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezfa1 a.211.1.0 (A:580-919) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
kaaelyervasnrehwtkvshkftirglpsnnsldfldee

SCOPe Domain Coordinates for d6ezfa1:

Click to download the PDB-style file with coordinates for d6ezfa1.
(The format of our PDB-style files is described here.)

Timeline for d6ezfa1:

  • d6ezfa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6ezfa2