Lineage for d6f28a_ (6f28 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (146 species)
    not a true protein
  7. 2487773Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (100 PDB entries)
  8. 3050365Domain d6f28a_: 6f28 A: [350427]
    automated match to d3u92a_
    complexed with cg8, cl, so4, zn

Details for d6f28a_

PDB Entry: 6f28 (more details), 2.4 Å

PDB Description: crystal structure of the kainate receptor gluk3 ligand binding domain in complex with (s)-1-[2'-amino-2'-carboxyethyl]-6-methyl-5,7- dihydropyrrolo[3,4-d]pyrimidin-2,4(1h,3h)-dione at resolution 2.4a
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 3,Glutamate receptor ionotropic, kainate 3

SCOPe Domain Sequences for d6f28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f28a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
himkekwwrgsgcp

SCOPe Domain Coordinates for d6f28a_:

Click to download the PDB-style file with coordinates for d6f28a_.
(The format of our PDB-style files is described here.)

Timeline for d6f28a_:

  • d6f28a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08