SCOPe 2.08: Domain d6ckqa1: 6ckq A:5-149

Lineage for d6ckqa1 (6ckq A:5-149)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (4 families)

5. Family a.79.1.0: automated matches [350421] (1 protein)
   not a true family

6. Protein automated matches [350422] (1 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [350423] (1 PDB entry)

8. Domain d6ckqa1: 6ckq A:5-149 [350424]
   Other proteins in same PDB: d6ckqa2
   automated match to d1baqa_

Details for d6ckqa1

PDB Entry: 6ckq

PDB Description: solution structure of the burkholderia thailandensis transcription antitermination protein nusb (bth_i1529) - seattle structural genomics center for infectious disease target butha.17903.a

PDB Compounds: (A:) Transcription antitermination protein NusB

SCOPe Domain Sequences for d6ckqa1:

Sequence; same for both SEQRES and ATOM records:

>d6ckqa1 a.79.1.0 (A:5-149) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkksarrqsrelatqglyqwllsnaapgeidaqlrgalgydkadktlldtilhgvireha
tlaeaispsldrpidqlspveravlliatyelthqietpyrviineavelaktfggsdgy
kyvngvldklavklrpaetqarrga

Timeline for d6ckqa1:

• d6ckqa1 first appeared in SCOPe 2.07