Lineage for d6ckqa1 (6ckq A:5-149)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327443Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2327444Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 3050359Family a.79.1.0: automated matches [350421] (1 protein)
    not a true family
  6. 3050360Protein automated matches [350422] (1 species)
    not a true protein
  7. 3050361Species Burkholderia thailandensis [TaxId:271848] [350423] (1 PDB entry)
  8. 3050362Domain d6ckqa1: 6ckq A:5-149 [350424]
    Other proteins in same PDB: d6ckqa2
    automated match to d1baqa_

Details for d6ckqa1

PDB Entry: 6ckq (more details)

PDB Description: solution structure of the burkholderia thailandensis transcription antitermination protein nusb (bth_i1529) - seattle structural genomics center for infectious disease target butha.17903.a
PDB Compounds: (A:) Transcription antitermination protein NusB

SCOPe Domain Sequences for d6ckqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckqa1 a.79.1.0 (A:5-149) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mkksarrqsrelatqglyqwllsnaapgeidaqlrgalgydkadktlldtilhgvireha
tlaeaispsldrpidqlspveravlliatyelthqietpyrviineavelaktfggsdgy
kyvngvldklavklrpaetqarrga

SCOPe Domain Coordinates for d6ckqa1:

Click to download the PDB-style file with coordinates for d6ckqa1.
(The format of our PDB-style files is described here.)

Timeline for d6ckqa1:

  • d6ckqa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6ckqa2