Lineage for d6cbza_ (6cbz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2336144Protein automated matches [190059] (14 species)
    not a true protein
  7. 2336166Species Human (Homo sapiens) [TaxId:9606] [187214] (157 PDB entries)
  8. 3050349Domain d6cbza_: 6cbz A: [350411]
    automated match to d3q95b_
    complexed with est, gol; mutant

Details for d6cbza_

PDB Entry: 6cbz (more details), 1.65 Å

PDB Description: estrogen receptor alpha ligand binding domain y537s mutant in complex with estradiol and grip peptide
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d6cbza_:

Sequence, based on SEQRES records: (download)

>d6cbza_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
l

Sequence, based on observed residues (ATOM records): (download)

>d6cbza_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
latssrfrmmnlqgeefvclksiillnsgvytdhihrvldkitdtlihlmakagltlqqq
hqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahrl

SCOPe Domain Coordinates for d6cbza_:

Click to download the PDB-style file with coordinates for d6cbza_.
(The format of our PDB-style files is described here.)

Timeline for d6cbza_:

  • d6cbza_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08