Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Caulobacter crescentus [TaxId:565050] [350377] (1 PDB entry) |
Domain d6esxb1: 6esx B:2-110 [350407] Other proteins in same PDB: d6esxa2, d6esxb2, d6esxc2 automated match to d4wxta_ |
PDB Entry: 6esx (more details), 2.8 Å
SCOPe Domain Sequences for d6esxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6esxb1 c.47.1.0 (B:2-110) automated matches {Caulobacter crescentus [TaxId: 565050]} stvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnied spttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaa
Timeline for d6esxb1:
View in 3D Domains from other chains: (mouse over for more information) d6esxa1, d6esxa2, d6esxc1, d6esxc2 |