Lineage for d6es0b_ (6es0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (27 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (977 PDB entries)
  8. 3050333Domain d6es0b_: 6es0 B: [350395]
    automated match to d4c8ba_
    complexed with bw8

Details for d6es0b_

PDB Entry: 6es0 (more details), 2.38 Å

PDB Description: crystal structure of the kinase domain of human ripk2 in complex with the activation loop targeting inhibitor cs-r35
PDB Compounds: (B:) receptor-interacting serine/threonine-protein kinase 2

SCOPe Domain Sequences for d6es0b_:

Sequence, based on SEQRES records: (download)

>d6es0b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlhihtplldserkdvl
reaeilhkarfsyilpilgicnepeflgivteympngslnellhrkteypdvawplrfri
lheialgvnylhnmtppllhhdlktqnilldnefhvkiadfglskwrmmslsqsrssksa
peggtiiymppenyepgqksrasikhdiysyavitwevlsrkqpfedvtnplqimysvsq
ghrpvineeslpydiphrarmisliesgwaqnpderpsflkclielepvlrtfeeitfle
aviqlkktklq

Sequence, based on observed residues (ATOM records): (download)

>d6es0b_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aicsalptipyhkladlrylsrgasgtvssarhadwrvqvavkhlserkdvlreaeilhk
arfsyilpilgicnepeflgivteympngslnellhrkteypdvawplrfrilheialgv
nylhnmtppllhhdlktqnilldnefhvkiadfglskwrgtiiymppenyepgqksrasi
khdiysyavitwevlsrkqpfedvtnplqimysvsqghrpvineeslpydiphrarmisl
iesgwaqnpderpsflkclielepvlrtfeeitfleaviqlkktklq

SCOPe Domain Coordinates for d6es0b_:

Click to download the PDB-style file with coordinates for d6es0b_.
(The format of our PDB-style files is described here.)

Timeline for d6es0b_:

  • d6es0b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08