Lineage for d6esxa1 (6esx A:2-110)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879354Species Caulobacter crescentus [TaxId:565050] [350377] (1 PDB entry)
  8. 2879355Domain d6esxa1: 6esx A:2-110 [350378]
    Other proteins in same PDB: d6esxa2, d6esxb2, d6esxc2
    automated match to d4wxta_

Details for d6esxa1

PDB Entry: 6esx (more details), 2.8 Å

PDB Description: caulobacter crescentus trx1
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d6esxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6esxa1 c.47.1.0 (A:2-110) automated matches {Caulobacter crescentus [TaxId: 565050]}
stvavtdatfeadvlksskpvlvdfwaewcgpckqiapaleqlseeladvvtiakvnied
spttpsrygvrgiptmmlfrdgqmtsmkvgampkqkilewlneagvqaa

SCOPe Domain Coordinates for d6esxa1:

Click to download the PDB-style file with coordinates for d6esxa1.
(The format of our PDB-style files is described here.)

Timeline for d6esxa1: