Lineage for d6ctyb_ (6cty B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2420241Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2420242Protein automated matches [190150] (26 species)
    not a true protein
  7. 2420452Species Yersinia pestis [TaxId:632] [331414] (2 PDB entries)
  8. 3050313Domain d6ctyb_: 6cty B: [350375]
    Other proteins in same PDB: d6ctyc2
    automated match to d4lfyb_
    complexed with mlt, zn

Details for d6ctyb_

PDB Entry: 6cty (more details), 2.41 Å

PDB Description: crystal structure of dihydroorotase pyrc from yersinia pestis in complex with zinc and malate at 2.4 a resolution
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d6ctyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ctyb_ c.1.9.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
pqtlkirrpddwhihlrddemlstvlpytsevfaraivmpnlaqpittvasaiayreril
aavpaghkftplmtcyltnsldakelttgfeqgvftaaklypanattnsthgvsdipaiy
plfeqmqkigmpllihgevtdaavdifdrearfidqilepirqkfpelkivfehittkda
adyvlagnrflgatvtpqhlmfnrnhmlvggirphlfclpilkrsthqqalraavasgsd
rfflgtdsaphakhrkesscgcagvfnapaalpayasvfeelnalqhleafcalngprfy
glpvnddvvelvrtpflqpeeiplgnesvipflagqtlnwsvk

SCOPe Domain Coordinates for d6ctyb_:

Click to download the PDB-style file with coordinates for d6ctyb_.
(The format of our PDB-style files is described here.)

Timeline for d6ctyb_:

  • d6ctyb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08