SCOPe 2.08: Domain d6ezjk2: 6ezj K:96-195

Lineage for d6ezjk2 (6ezj K:96-195)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)

8. Domain d6ezjk2: 6ezj K:96-195 [350368]
   Other proteins in same PDB: d6ezja1, d6ezjb1, d6ezjc1, d6ezjd1, d6ezje1, d6ezjf1, d6ezjg1, d6ezjh1, d6ezji1, d6ezjj1, d6ezjk1, d6ezjl1, d6ezjm1, d6ezjn1, d6ezjo1, d6ezjp1, d6ezjq1, d6ezjr1, d6ezjs1, d6ezjt1, d6ezju1, d6ezjv1, d6ezjw1, d6ezjx1
   automated match to d4mu3a2
   complexed with 5ld, mn

Details for d6ezjk2

PDB Entry: 6ezj, 3.1 Å

PDB Description: imidazoleglycerol-phosphate dehydratase

PDB Compounds: (K:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d6ezjk2:

Sequence; same for both SEQRES and ATOM records:

>d6ezjk2 d.14.1.9 (K:96-195) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrgg

Timeline for d6ezjk2:

• d6ezjk2 first appeared in SCOPe 2.07