Lineage for d6ezjh1 (6ezj H:11-95)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500971Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2500972Protein automated matches [190826] (18 species)
    not a true protein
  7. 2501090Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (10 PDB entries)
  8. 3050300Domain d6ezjh1: 6ezj H:11-95 [350362]
    Other proteins in same PDB: d6ezja2, d6ezjb2, d6ezjc2, d6ezjd2, d6ezje2, d6ezjf2, d6ezjg2, d6ezjh2, d6ezji2, d6ezjj2, d6ezjk2, d6ezjl2, d6ezjm2, d6ezjn2, d6ezjo2, d6ezjp2, d6ezjq2, d6ezjr2, d6ezjs2, d6ezjt2, d6ezju2, d6ezjv2, d6ezjw2, d6ezjx2
    automated match to d4mu3a1
    complexed with 5ld, mn

Details for d6ezjh1

PDB Entry: 6ezj (more details), 3.1 Å

PDB Description: imidazoleglycerol-phosphate dehydratase
PDB Compounds: (H:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d6ezjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezjh1 d.14.1.0 (H:11-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdthi
ddhhtnedvalaigtallkalgerk

SCOPe Domain Coordinates for d6ezjh1:

Click to download the PDB-style file with coordinates for d6ezjh1.
(The format of our PDB-style files is described here.)

Timeline for d6ezjh1:

  • d6ezjh1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6ezjh2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ezja1, d6ezja2, d6ezjb1, d6ezjb2, d6ezjc1, d6ezjc2, d6ezjd1, d6ezjd2, d6ezje1, d6ezje2, d6ezjf1, d6ezjf2, d6ezjg1, d6ezjg2, d6ezji1, d6ezji2, d6ezjj1, d6ezjj2, d6ezjk1, d6ezjk2, d6ezjl1, d6ezjl2, d6ezjm1, d6ezjm2, d6ezjn1, d6ezjn2, d6ezjo1, d6ezjo2, d6ezjp1, d6ezjp2, d6ezjq1, d6ezjq2, d6ezjr1, d6ezjr2, d6ezjs1, d6ezjs2, d6ezjt1, d6ezjt2, d6ezju1, d6ezju2, d6ezjv1, d6ezjv2, d6ezjw1, d6ezjw2, d6ezjx1, d6ezjx2