Lineage for d6ckta1 (6ckt A:1-271)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403226Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 protein domains)
    contains extra N-terminal 3-helical domain
  6. 2403243Protein automated matches [191042] (4 species)
    not a true protein
  7. 3050297Species Legionella pneumophila [TaxId:272624] [350359] (1 PDB entry)
  8. 3050298Domain d6ckta1: 6ckt A:1-271 [350360]
    Other proteins in same PDB: d6ckta2
    automated match to d3tdta_
    complexed with edo

Details for d6ckta1

PDB Entry: 6ckt (more details), 1.8 Å

PDB Description: crystal structure of 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n- succinyltransferase from legionella pneumophila philadelphia 1
PDB Compounds: (A:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d6ckta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckta1 b.81.1.2 (A:1-271) automated matches {Legionella pneumophila [TaxId: 272624]}
mnslqdlieqafenrqnlsldtassdlinainevlsgldngqfrvaekingewtvhqwlk
kavllsfklfpnqiidagfckfydkiplkytdcsneqfqqsgvrvvphamvrrgayiakn
tvlmpsyvnigayidegvmvdtwatvgscaqigknvhisggagiggvleplqanptiied
ncfigarseivegviveknsvismgvflgqstkiynritgevsygripagsvvvagnlps
hdgshslycavivkqvdektrakvsindllr

SCOPe Domain Coordinates for d6ckta1:

Click to download the PDB-style file with coordinates for d6ckta1.
(The format of our PDB-style files is described here.)

Timeline for d6ckta1:

  • d6ckta1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6ckta2