Lineage for d6c6xf1 (6c6x F:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2358902Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (20 PDB entries)
  8. 3050292Domain d6c6xf1: 6c6x F:1-106 [350354]
    automated match to d1dn0a1

Details for d6c6xf1

PDB Entry: 6c6x (more details), 1.99 Å

PDB Description: crystal structure of middle-east respiratory syndrome (mers) coronavirus neutralizing antibody jc57-14 isolated from a vaccinated rhesus macaque.
PDB Compounds: (F:) JC57-14 Light chain

SCOPe Domain Sequences for d6c6xf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c6xf1 b.1.1.0 (F:1-106) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
diqmtqspsslsasvgdrvtitcrasqdinnylswyqqkpgkapkpliyyassletgvps
rfsgsrsgtdytltisslqledfatyycqqynnspysfgqgtkvei

SCOPe Domain Coordinates for d6c6xf1:

Click to download the PDB-style file with coordinates for d6c6xf1.
(The format of our PDB-style files is described here.)

Timeline for d6c6xf1:

  • d6c6xf1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08