Lineage for d6aoda2 (6aod A:107-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (788 PDB entries)
  8. 3050288Domain d6aoda2: 6aod A:107-214 [350350]
    Other proteins in same PDB: d6aoda1, d6aodc_
    automated match to d1dn0a2
    complexed with co, gol, po4, so4

Details for d6aoda2

PDB Entry: 6aod (more details), 1.8 Å

PDB Description: fxia antibody complex
PDB Compounds: (A:) FXIa Antibody FAB Light Chain

SCOPe Domain Sequences for d6aoda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aoda2 b.1.1.2 (A:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6aoda2:

Click to download the PDB-style file with coordinates for d6aoda2.
(The format of our PDB-style files is described here.)

Timeline for d6aoda2:

  • d6aoda2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6aoda1
View in 3D
Domains from other chains:
(mouse over for more information)
d6aodc_