Lineage for d6aoda1 (6aod A:8-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1058 PDB entries)
  8. 3050287Domain d6aoda1: 6aod A:8-106 [350349]
    Other proteins in same PDB: d6aoda2, d6aodc_
    automated match to d1dn0a1
    complexed with co, gol, po4, so4

Details for d6aoda1

PDB Entry: 6aod (more details), 1.8 Å

PDB Description: fxia antibody complex
PDB Compounds: (A:) FXIa Antibody FAB Light Chain

SCOPe Domain Sequences for d6aoda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aoda1 b.1.1.0 (A:8-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslqsgvpsrfsgsgs
gteftltisslqpedfatyyclqhdiyastfgpgtkvdi

SCOPe Domain Coordinates for d6aoda1:

Click to download the PDB-style file with coordinates for d6aoda1.
(The format of our PDB-style files is described here.)

Timeline for d6aoda1:

  • d6aoda1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6aoda2
View in 3D
Domains from other chains:
(mouse over for more information)
d6aodc_