SCOPe 2.08: Domain d6evqa_: 6evq A:

Lineage for d6evqa_ (6evq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [350342] (2 PDB entries)

8. Domain d6evqa_: 6evq A: [350345]
   automated match to d1wu9b_
   complexed with c05

Details for d6evqa_

PDB Entry: 6evq

PDB Description: solution nmr structure of eb1 c terminus (191-260) with a small molecule bound into the sxip binding site

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d6evqa_:

Sequence; same for both SEQRES and ATOM records:

>d6evqa_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvipdegg

Timeline for d6evqa_:

• d6evqa_ first appeared in SCOPe 2.07