Lineage for d6evqa_ (6evq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343400Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2343401Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2343402Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2343403Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 3050280Species Mus musculus [TaxId:10090] [350342] (2 PDB entries)
  8. 3050283Domain d6evqa_: 6evq A: [350345]
    automated match to d1wu9b_
    complexed with c05

Details for d6evqa_

PDB Entry: 6evq (more details)

PDB Description: solution nmr structure of eb1 c terminus (191-260) with a small molecule bound into the sxip binding site
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d6evqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6evqa_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Mus musculus [TaxId: 10090]}
deaaelmqqvkvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvipdegg

SCOPe Domain Coordinates for d6evqa_:

Click to download the PDB-style file with coordinates for d6evqa_.
(The format of our PDB-style files is described here.)

Timeline for d6evqa_:

  • d6evqa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08