Lineage for d6cadb1 (6cad B:449-705)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (625 PDB entries)
  8. 3050278Domain d6cadb1: 6cad B:449-705 [350340]
    Other proteins in same PDB: d6cada2, d6cadb2
    automated match to d4e26b_
    complexed with eu4

Details for d6cadb1

PDB Entry: 6cad (more details), 2.55 Å

PDB Description: crystal structure of raf kinase domain bound to the inhibitor 2a
PDB Compounds: (B:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d6cadb1:

Sequence, based on SEQRES records: (download)

>d6cadb1 d.144.1.7 (B:449-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt
rhvnillfmgystkpqlaivtqwcegsslyhhlhasetkfemkklidiarqtargmdylh
aksiihrdlksnniflhedntvkigdfglatvksrwsgshqfeqlsgsilwmapevirmq
dsnpysfqsdvyafgivlyelmtgqlpysninnrdqiiemvgrgslspdlskvrsncpkr
mkrlmaeclkkkrderp

Sequence, based on observed residues (ATOM records): (download)

>d6cadb1 d.144.1.7 (B:449-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dweipdgqitvgqrigsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrktrh
vnillfmgystkpqlaivtqwcegsslyhhlhastkfemkklidiarqtargmdylhaks
iihrdlksnniflhedntvkigdfsgsilwmapevirmpysfqsdvyafgivlyelmtgq
lpysninnrdqiiemvgrgslspdlskvrsncpkrmkrlmaeclkkkrderp

SCOPe Domain Coordinates for d6cadb1:

Click to download the PDB-style file with coordinates for d6cadb1.
(The format of our PDB-style files is described here.)

Timeline for d6cadb1:

  • d6cadb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6cadb2