Lineage for d6c8qa_ (6c8q A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2443548Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2443822Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2443823Protein automated matches [190116] (26 species)
    not a true protein
  7. 3049936Species Enterococcus faecalis [TaxId:226185] [349998] (1 PDB entry)
  8. 3050277Domain d6c8qa_: 6c8q A: [350339]
    automated match to d4q16a_
    complexed with nad

Details for d6c8qa_

PDB Entry: 6c8q (more details), 2.58 Å

PDB Description: crystal structure of nad synthetase (nade) from enterococcus faecalis in complex with nad+
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d6c8qa_:

Sequence, based on SEQRES records: (download)

>d6c8qa_ c.26.2.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
ttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrla
qlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamvg
slenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdggad
ilplfrlnkrqgkallkelgapealylkiptadleddkplvadevalgvtydaiddyleg
kkvsetdqqtienwykkgqhkrhlpitifddfwk

Sequence, based on observed residues (ATOM records): (download)

>d6c8qa_ c.26.2.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
ttlqekiiqelgvlptidpkeevrksidflkayltkhpflktfvlgisggqdstlagrla
qlamtemreetgdmsyqfiairlpygeqadeadaqaalafiqpdvslrvdikpavdamvg
slenagvqisdfnkgnmkarqrmitqyavagenagavigtdhaaenvtafftkygdggad
ilplfrlnkrqgkallkelgapealylkeddkplvadevalgvtydaiddylegkkvset
dqqtienwykkgqhkrhlpitifddfwk

SCOPe Domain Coordinates for d6c8qa_:

Click to download the PDB-style file with coordinates for d6c8qa_.
(The format of our PDB-style files is described here.)

Timeline for d6c8qa_:

  • d6c8qa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08