Lineage for d6cpyb_ (6cpy B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (26 species)
    not a true protein
  7. 3050270Species Zea mays [TaxId:4577] [350332] (1 PDB entry)
  8. 3050271Domain d6cpyb_: 6cpy B: [350333]
    automated match to d4yfia_

Details for d6cpyb_

PDB Entry: 6cpy (more details), 1.7 Å

PDB Description: structure of apo grmzm2g135359 pseudokinase
PDB Compounds: (B:) GRMZM2G135359 pseudokinase

SCOPe Domain Sequences for d6cpyb_:

Sequence, based on SEQRES records: (download)

>d6cpyb_ d.144.1.0 (B:) automated matches {Zea mays [TaxId: 4577]}
fvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwsken
esqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekldw
marlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwndakghnstt
nnelafspdmedivrkygmvlleiltgrvpsseddgplenwvsryfeggmrleelidpsi
gffpedtaralcevvrscidrdpkkrpqmkevaarmreitalgp

Sequence, based on observed residues (ATOM records): (download)

>d6cpyb_ d.144.1.0 (B:) automated matches {Zea mays [TaxId: 4577]}
fvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwsken
esqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekldw
marlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwnspdmedivr
kygmvlleiltgrvplenwvsryfeggmrleelidpsigffpedtaralcevvrscidrd
pkkrpqmkevaarmreitalgp

SCOPe Domain Coordinates for d6cpyb_:

Click to download the PDB-style file with coordinates for d6cpyb_.
(The format of our PDB-style files is described here.)

Timeline for d6cpyb_:

  • d6cpyb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08