Lineage for d6cnxd_ (6cnx D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1001 PDB entries)
  8. 3050259Domain d6cnxd_: 6cnx D: [350321]
    automated match to d6bu6a_
    complexed with act, f87, fcs, gol, so4

Details for d6cnxd_

PDB Entry: 6cnx (more details), 2 Å

PDB Description: crystal structure of the human vaccinia-related kinase 1 (vrk1) bound to an n-propynyl-n-isopentyl-dihydropteridin inhibitor
PDB Compounds: (D:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d6cnxd_:

Sequence, based on SEQRES records: (download)

>d6cnxd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngplfte
lkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiye
anakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayr
ycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwed
nlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdi
llqglkaigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d6cnxd_ d.144.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avgeiitdmaaaawkvglpiciyladmnssesvgsdapcvvkvepsdngplftelkfyqr
aakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeanakrf
srktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegv
hkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpk
yvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglk
aigskddgkldl

SCOPe Domain Coordinates for d6cnxd_:

Click to download the PDB-style file with coordinates for d6cnxd_.
(The format of our PDB-style files is described here.)

Timeline for d6cnxd_:

  • d6cnxd_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08