Lineage for d6elqx_ (6elq X:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574099Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 2574100Superfamily e.26.1: Prismane protein-like [56821] (4 families) (S)
  5. 3050237Family e.26.1.0: automated matches [350299] (1 protein)
    not a true family
  6. 3050238Protein automated matches [350300] (1 species)
    not a true protein
  7. 3050239Species Carboxydothermus hydrogenoformans [TaxId:129958] [350301] (1 PDB entry)
  8. 3050255Domain d6elqx_: 6elq X: [350317]
    automated match to d1su8a_
    complexed with bf8, sf4

Details for d6elqx_

PDB Entry: 6elq (more details), 2.52 Å

PDB Description: carbon monoxide dehydrogenase iv from carboxydothermus hydrogenoformans
PDB Compounds: (X:) carbon monoxide dehydrogenase

SCOPe Domain Sequences for d6elqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elqx_ e.26.1.0 (X:) automated matches {Carboxydothermus hydrogenoformans [TaxId: 129958]}
sklsvdpvipnlyrkareegistvfdryeaqqpqcgfgltglccrhcvqgpcridpfgeg
pqagicgataevitarnllrqvtagaaahvdhaydvlevleqiaqgtesysikdqeklkq
vaftlgidtankteqeiveemcqiiyrdfansgatpmtylkansprerletweklgvlpr
npdreirealhqttmgmdadpvnlilktirlglvdgfaglklatdlqdiifgtpqpvvte
anlgvlkedyvniivhghvpllsekivewsrkledeakkagakginlagicctgnevlmr
qgvplatnflaqelaiitgavdlmvvdvqcimpslaeiaacyhtrlvttmpivkipgaeh
vpfttetadeasqqivrmaiesyqkrnpakvyiprekakvvagfsveaivkalaklnpdd
plkplidnivsgnilgvvatvgcnnvkvkhdwfhielvkeliknnvlvvttgcsahalak
aglmdpaaaewageglravltaigtandlggplppvlhmgscvdnsrigdlviavanylk
vspkdlpiaasapeyqhekalsigtwavamgimthlgvvppvvgsskvtriltqdaeali
ggkfyvetdpykaaagiiehikakrallnl

SCOPe Domain Coordinates for d6elqx_:

Click to download the PDB-style file with coordinates for d6elqx_.
(The format of our PDB-style files is described here.)

Timeline for d6elqx_:

  • d6elqx_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08