Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (17 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [350191] (1 PDB entry) |
Domain d6cond_: 6con D: [350311] automated match to d5n00b_ |
PDB Entry: 6con (more details), 2.1 Å
SCOPe Domain Sequences for d6cond_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cond_ c.124.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} straevcavacaelfrdageimispmtnmasvgarlarltfapdilltdgeaqlladtpa lgktgapnriegwmpfgrvfetlawgrrhvvmganqvdrygnqnisafgplqrptrqmfg vrgspgntinhatsywvgnhckrvfveavdvvsgigydkvdpdnpafrfvnvyrvvsnlg vfdfggpdhsmravslhpgvtpgdvrdatsfevhdldaaeqtrlptddelhliravidpk slrdreirs
Timeline for d6cond_: