Lineage for d6cu3e_ (6cu3 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894916Species Naegleria fowleri [TaxId:5763] [350234] (2 PDB entries)
  8. 2894921Domain d6cu3e_: 6cu3 E: [350310]
    automated match to d1oria_
    complexed with edo

Details for d6cu3e_

PDB Entry: 6cu3 (more details), 2.5 Å

PDB Description: crystal structure of a protein arginine n-methyltransferase from naegleria fowleri
PDB Compounds: (E:) protein arginine N-methyltransferase

SCOPe Domain Sequences for d6cu3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cu3e_ c.66.1.0 (E:) automated matches {Naegleria fowleri [TaxId: 5763]}
emlkdgirtnayknailqnkhlfkdkvvldigcgtgilclfaakagakrvigidmsdiid
karqivsdngyshvielikgkvediaqlpfgiekvdiiisewmgyfllyesmlqtvlsar
drwlrpggylfpdkctmyicgiedseykrdkidfwdnvygfnfsaikadalreplvdfve
sqqiittqskfleidlntiqpedlkqittsfeftsqyqeycqafvawfdcvfsrgphkpv
efstgpftegthwkqtvfylendlplkpndvikgtitisqnksnhrdldismkytvngga
visqdyimr

SCOPe Domain Coordinates for d6cu3e_:

Click to download the PDB-style file with coordinates for d6cu3e_.
(The format of our PDB-style files is described here.)

Timeline for d6cu3e_: