Lineage for d6cexe1 (6cex E:11-326)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (36 species)
    not a true protein
  7. 2371579Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (14 PDB entries)
  8. 3050246Domain d6cexe1: 6cex E:11-326 [350308]
    Other proteins in same PDB: d6cexa2, d6cexb_, d6cexc2, d6cexd_, d6cexe2, d6cexf_
    automated match to d4xkga_
    complexed with bma, gol, man, nag, nhe, so4

Details for d6cexe1

PDB Entry: 6cex (more details), 2.57 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with small molecule n-cyclohexyltaurine
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d6cexe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cexe1 b.19.1.0 (E:11-326) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpek

SCOPe Domain Coordinates for d6cexe1:

Click to download the PDB-style file with coordinates for d6cexe1.
(The format of our PDB-style files is described here.)

Timeline for d6cexe1:

  • d6cexe1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08