Lineage for d6ckwb1 (6ckw B:2-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2442887Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2442890Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 3050242Domain d6ckwb1: 6ckw B:2-159 [350304]
    Other proteins in same PDB: d6ckwb2
    automated match to d1gn8a_
    complexed with dms, f6d, pg4, so4

Details for d6ckwb1

PDB Entry: 6ckw (more details), 2.06 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with (r)-3- ((7-(((s)-2-amino-2-(2-methoxyphenyl)ethyl)amino)-5-methyl-[1,2, 4]triazolo[1,5-a]pyrimidin-2-yl)amino)-3-(3-chlorophenyl) propanenitrile
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6ckwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckwb1 c.26.1.3 (B:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
kewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6ckwb1:

Click to download the PDB-style file with coordinates for d6ckwb1.
(The format of our PDB-style files is described here.)

Timeline for d6ckwb1:

  • d6ckwb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6ckwb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ckwa_