Lineage for d6c43d_ (6c43 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 3049913Species Salmonella choleraesuis [TaxId:28901] [349975] (1 PDB entry)
  8. 3050241Domain d6c43d_: 6c43 D: [350303]
    automated match to d3jz4a_

Details for d6c43d_

PDB Entry: 6c43 (more details), 2.9 Å

PDB Description: 2.9 angstrom resolution crystal structure of gamma-aminobutyraldehyde dehydrogenase from salmonella typhimurium.
PDB Compounds: (D:) Gamma-aminobutyraldehyde dehydrogenase

SCOPe Domain Sequences for d6c43d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c43d_ c.82.1.0 (D:) automated matches {Salmonella choleraesuis [TaxId: 28901]}
qyqllingvlvdgegerqsvynpatgevileiaeaspaqvdaavqaadnafaewgqttpk
araecllkladsieqnalefarlesqncgkplhcvindeipaivdvfrffagaarclsgl
aageyleghtsmirrdpigvvasiapwnyplmmaawklapalaagncvvikpseitplta
lklavlakdifppgvlnvlfgrgqtvgdvltghekvrmvsltgsiatgehilrhtapaik
rthmelggkapvivfddadldavaqgvrtfgfynagqdctaacriyaqrgiydalveklg
navsslkmgapedestelgplsslahlkrvtaaveeakalshirvitggsqtegkgyyfa
ptlladakqedaivqrevfgpvvsitvfddedqvlrwandsryglassvwtqdvgrahrl
sarlqygctwinthfmlvsemphggqkqsgygkdmslygledytlvrhimvkh

SCOPe Domain Coordinates for d6c43d_:

Click to download the PDB-style file with coordinates for d6c43d_.
(The format of our PDB-style files is described here.)

Timeline for d6c43d_:

  • d6c43d_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08