Lineage for d6c5cb1 (6c5c B:1-387)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573692Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2573693Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2573762Family e.22.1.0: automated matches [191565] (1 protein)
    not a true family
  6. 2573763Protein automated matches [190982] (9 species)
    not a true protein
  7. 3049999Species Candida albicans [TaxId:237561] [350061] (1 PDB entry)
  8. 3050226Domain d6c5cb1: 6c5c B:1-387 [350288]
    Other proteins in same PDB: d6c5ca2, d6c5cb2
    automated match to d1sg6a_
    complexed with cl, edo, nad

Details for d6c5cb1

PDB Entry: 6c5c (more details), 1.85 Å

PDB Description: crystal structure of aro1p from candida albicans sc5314 in complex with nadh
PDB Compounds: (B:) 3-dehydroquinate synthase

SCOPe Domain Sequences for d6c5cb1:

Sequence, based on SEQRES records: (download)

>d6c5cb1 e.22.1.0 (B:1-387) automated matches {Candida albicans [TaxId: 237561]}
msiekvpilgketihvgygiadhivrevianlasstyvivtdtnmartpqyskltddfkt
nlsekrpesrlltycvspgennknratkaavedfllqqgctrdtvilavgggvigdmigf
vaatfmrgvrvvqvpttllamvdssvggktaidtplgknfigafhqpeyvfcdvsfletl
parqfingmaevvktaaiwneeeftrlenfskkflsvvtskkpdlqsikaelvktvlesv
rvkagvvssdekeaglrnllnfghtighaieavltpealhgecvsigmikeaelsrylgi
lppvavarlskclvayglpvsiddkeflkkvgpkrhyveidillkkmaidkkndgskirc
vllekigkcyqlkahqvskqdlsfvlt

Sequence, based on observed residues (ATOM records): (download)

>d6c5cb1 e.22.1.0 (B:1-387) automated matches {Candida albicans [TaxId: 237561]}
msiekvpilgketihvgygiadhivrevianlasstyvivtdtnmartpqyskltddfkt
nlsekrpesrlltycvspgennknratkaavedfllqqgctrdtvilavgggvigdmigf
vaatfmrgvrvvqvpttllamvdssvggktaidtplgknfigafhqpeyvfcdvsfletl
parqfingmaevvktaaiwneeeftrlenfskkflsvvtskkpdlqsikaelvktvlesv
rvkagvvssdekeaglrnllnfghtighaieavltpealhgecvsigmikeaelsrylgi
lppvavarlskclvayglpvsiddkeflkkvgpkrhyveidillkkmaskircvllekig
kcyqlkahqvskqdlsfvlt

SCOPe Domain Coordinates for d6c5cb1:

Click to download the PDB-style file with coordinates for d6c5cb1.
(The format of our PDB-style files is described here.)

Timeline for d6c5cb1:

  • d6c5cb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6c5cb2