Lineage for d6chna_ (6chn A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2442887Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2442890Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 3050219Domain d6chna_: 6chn A: [350281]
    Other proteins in same PDB: d6chnb2
    automated match to d1gn8a_
    complexed with f1d, peg, pg4, so4

Details for d6chna_

PDB Entry: 6chn (more details), 2.03 Å

PDB Description: phosphopantetheine adenylyltransferase (coad) in complex with methyl (r)-4-(3-(2-cyano-1-((5-methyl-7-oxo-4,7-dihydro-[1,2,4]triazolo[1,5- a]pyrimidin-2-yl)amino)ethyl)phenoxy)piperidine-1-carboxylate
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6chna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chna_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6chna_:

Click to download the PDB-style file with coordinates for d6chna_.
(The format of our PDB-style files is described here.)

Timeline for d6chna_:

  • d6chna_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08