Lineage for d6cjbb_ (6cjb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897365Species Legionella pneumophila [TaxId:272624] [350056] (4 PDB entries)
  8. 2897374Domain d6cjbb_: 6cjb B: [350280]
    automated match to d5dx5a_
    complexed with fmt, gol, llp

Details for d6cjbb_

PDB Entry: 6cjb (more details), 1.75 Å

PDB Description: crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 covalently bound to pyridoxal phosphate
PDB Compounds: (B:) Cystathionine beta-lyase

SCOPe Domain Sequences for d6cjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cjbb_ c.67.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci
aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf
idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi
qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl
vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi
slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi
rlsvgiehiddlradlehalg

SCOPe Domain Coordinates for d6cjbb_:

Click to download the PDB-style file with coordinates for d6cjbb_.
(The format of our PDB-style files is described here.)

Timeline for d6cjbb_: