Lineage for d6c7aa1 (6c7a A:28-287)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 3050181Domain d6c7aa1: 6c7a A:28-287 [350243]
    Other proteins in same PDB: d6c7aa2
    automated match to d4hbta_
    complexed with so4

Details for d6c7aa1

PDB Entry: 6c7a (more details), 1.05 Å

PDB Description: conformational changes in a class a beta lactamase that prime it for catalysis
PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d6c7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7aa1 e.3.1.1 (A:28-287) automated matches {Escherichia coli [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcatskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrteptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaenrndilaaaakivthgf

SCOPe Domain Coordinates for d6c7aa1:

Click to download the PDB-style file with coordinates for d6c7aa1.
(The format of our PDB-style files is described here.)

Timeline for d6c7aa1:

  • d6c7aa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6c7aa2