Lineage for d6ekgy_ (6ekg Y:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 3050156Species Methanococcus maripaludis [TaxId:39152] [350218] (2 PDB entries)
  8. 3050157Domain d6ekgy_: 6ekg Y: [350219]
    automated match to d4hnra_
    complexed with mg

Details for d6ekgy_

PDB Entry: 6ekg (more details), 1.15 Å

PDB Description: crystal structure of an archaeal chey from methanoccocus maripaludis
PDB Compounds: (Y:) Chemotaxis protein cheY

SCOPe Domain Sequences for d6ekgy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekgy_ c.23.1.0 (Y:) automated matches {Methanococcus maripaludis [TaxId: 39152]}
sivktmivddsafmrnilkrilsttnkyvvigeaangadaikmaeelqpdlismdivmpe
tdgitatkaikektpeikivmctsvdqeqkmidavnagadgyivkpfqapkileqfnklf
p

SCOPe Domain Coordinates for d6ekgy_:

Click to download the PDB-style file with coordinates for d6ekgy_.
(The format of our PDB-style files is described here.)

Timeline for d6ekgy_:

  • d6ekgy_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07