SCOPe 2.08: Domain d6coma1: 6com A:7-227

Lineage for d6coma1 (6com A:7-227)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein automated matches [257342] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)

8. Domain d6coma1: 6com A:7-227 [350200]
   Other proteins in same PDB: d6coma2
   automated match to d1os1a2
   complexed with atp, ca, mg, pyr; mutant

Details for d6coma1

PDB Entry: 6com, 2.3 Å

PDB Description: 2.3a crystal structure of e. coli phosphoenolpyruvate carboxykinase mutant asp269asn

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6coma1:

Sequence; same for both SEQRES and ATOM records:

>d6coma1 c.109.1.1 (A:7-227) automated matches {Escherichia coli [TaxId: 83333]}
ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
senfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d6coma1:

• d6coma1 first appeared in SCOPe 2.07