Lineage for d6coma1 (6com A:7-227)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491927Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2491928Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2491929Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2492020Protein automated matches [257342] (3 species)
    not a true protein
  7. 3050137Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)
  8. 3050138Domain d6coma1: 6com A:7-227 [350200]
    Other proteins in same PDB: d6coma2
    automated match to d1os1a2
    complexed with atp, ca, mg, pyr; mutant

Details for d6coma1

PDB Entry: 6com (more details), 2.3 Å

PDB Description: mutagenic studies of e.coli pck with asp269asn mutation was purified crystallized and the structure was solved to 2.3a
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6coma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6coma1 c.109.1.1 (A:7-227) automated matches {Escherichia coli [TaxId: 83333]}
ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
senfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6coma1:

Click to download the PDB-style file with coordinates for d6coma1.
(The format of our PDB-style files is described here.)

Timeline for d6coma1:

  • d6coma1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07

View in 3D
Domains from same chain:
(mouse over for more information)
d6coma2