![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) ![]() |
![]() | Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins) duplication: 6 repeats of this fold are organized in two RPTC-like domains automatically mapped to Pfam PF00275 |
![]() | Protein automated matches [190917] (10 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:160488] [350171] (1 PDB entry) |
![]() | Domain d6cn1f_: 6cn1 F: [350182] Other proteins in same PDB: d6cn1a2, d6cn1h2 automated match to d1nawa_ complexed with 0v5, cl, epu, mg |
PDB Entry: 6cn1 (more details), 2.75 Å
SCOPe Domain Sequences for d6cn1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cn1f_ d.68.2.2 (F:) automated matches {Pseudomonas putida [TaxId: 160488]} mdkliitggarldgeirisgaknaalpilaatlladgpvtvgnlphlhdittmielfgrm giepvideklsveidprtiktlvapyelvktmrasilvlgpmvarfgeaevalpggcaig srpvdlhirgleamgakieveggyikakapegglrgahfffdtvsvtgtenimmaaalak grsvlqnaarepevvdlanfinamggniqgagtdtitidgverldsanyrvmpdrietgt ylvaaavtggrvkvkdtdptileavleklkeagadintgedwieldmhgkrpkavnlrta pypafptdmqaqfislnaiaegtgavietifenrfmhvyemhrmgaqiqvegntaivtgv kalkgapvmatdlrasaslvlsalvaegdtlidriyhidrgyecieeklqmlgakirrvp g
Timeline for d6cn1f_: