SCOPe 2.08: Domain d6ciga1: 6cig A:4-108

Lineage for d6ciga1 (6cig A:4-108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Isoflavone O-methyltransferase [63478] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (2 PDB entries)

8. Domain d6ciga1: 6cig A:4-108 [350140]
   Other proteins in same PDB: d6ciga2
   automated match to d1fp2a1
   complexed with gol, pg4, sah, so4, t3a

Details for d6ciga1

PDB Entry: 6cig, 1.65 Å

PDB Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase

PDB Compounds: (A:) Isoflavone-7-O-methyltransferase 8

SCOPe Domain Sequences for d6ciga1:

Sequence; same for both SEQRES and ATOM records:

>d6ciga1 a.4.5.29 (A:4-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
singrkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqv
psskignvrrlmrylahngffeiitkeeesyaltvasellvrgsd

Timeline for d6ciga1:

• d6ciga1 first appeared in SCOPe 2.07