SCOPe 2.08: Domain d6cc6a2: 6cc6 A:441-748

Lineage for d6cc6a2 (6cc6 A:441-748)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [350085] (5 PDB entries)

8. Domain d6cc6a2: 6cc6 A:441-748 [350126]
   automated match to d2ccda2
   complexed with hem, mpd, na, oxy, po4

Details for d6cc6a2

PDB Entry: 6cc6, 1.8 Å

PDB Description: crystal structure of the w202f variant of catalase-peroxidase from b. pseudomallei

PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d6cc6a2:

Sequence; same for both SEQRES and ATOM records:

>d6cc6a2 a.93.1.0 (A:441-748) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

Timeline for d6cc6a2:

• d6cc6a2 first appeared in SCOPe 2.07