Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Catharanthus roseus [TaxId:4058] [350051] (2 PDB entries) |
Domain d6c8ra1: 6c8r A:17-371 [350118] Other proteins in same PDB: d6c8ra2 automated match to d1m6ex_ complexed with eqv, sah |
PDB Entry: 6c8r (more details), 1.95 Å
SCOPe Domain Sequences for d6c8ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c8ra1 c.66.1.0 (A:17-371) automated matches {Catharanthus roseus [TaxId: 4058]} veahpmkggddshsysqnscyqkgvidaakaviveavnekldlennpifdpikpfriadf gcstgpntfhamqnivesvetkykslqktpefhvffndhvnndfnvlfrslppnreffaa gvpgsfytrvfpknsihfahcsyalhwlskvpkeiqdknslaynkgrihytgtekhvvka yfgqfqrdfegflkaraqeivvgglmviqipglpsgevlfsrtgagllhfllgtslmelv nkgiineesvdsfnlpqyhpsvedlemviemndcftiervgtlphpmknlpfdvqrtslq vraimeciltehfgenildplfeiytknlqenfhvfdkeirkdadlylvlkrkgn
Timeline for d6c8ra1: