Lineage for d6chda2 (6chd A:222-576)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968077Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2968094Domain d6chda2: 6chd A:222-576 [350117]
    Other proteins in same PDB: d6chda1, d6chdb1
    automated match to d3bjua2
    protein/RNA complex; complexed with edo, gol, kaa, so4

Details for d6chda2

PDB Entry: 6chd (more details), 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase complexed with l- lysylsulfamoyl adenosine
PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6chda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6chda2 d.104.1.0 (A:222-576) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkpe

SCOPe Domain Coordinates for d6chda2:

Click to download the PDB-style file with coordinates for d6chda2.
(The format of our PDB-style files is described here.)

Timeline for d6chda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6chda1