Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
Domain d6chda2: 6chd A:222-576 [350117] Other proteins in same PDB: d6chda1, d6chdb1 automated match to d3bjua2 protein/RNA complex; complexed with edo, gol, kaa, so4 |
PDB Entry: 6chd (more details), 2.5 Å
SCOPe Domain Sequences for d6chda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6chda2 d.104.1.0 (A:222-576) automated matches {Human (Homo sapiens) [TaxId: 9606]} dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkpe
Timeline for d6chda2: