SCOPe 2.07: Domain d6cb4a2: 6cb4 A:244-424

Lineage for d6cb4a2 (6cb4 A:244-424)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (31 species)
   not a true protein

7. Species Canavalia ensiformis [TaxId:3823] [350078] (1 PDB entry)

8. Domain d6cb4a2: 6cb4 A:244-424 [350080]
   automated match to d1uika2
   complexed with bez

Details for d6cb4a2

PDB Entry: 6cb4, 1.3 Å

PDB Description: high resolution structure of the hexagonal crystal form of the vicilin protein canavalin in complex with endogenous benzoic acid

PDB Compounds: (A:) canavalin

SCOPe Domain Sequences for d6cb4a2:

Sequence; same for both SEQRES and ATOM records:

>d6cb4a2 b.82.1.0 (A:244-424) automated matches {Canavalia ensiformis [TaxId: 3823]}
sqnkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsrat
vilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaasdln
mvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp
r

Timeline for d6cb4a2:

• d6cb4a2 is new in SCOPe 2.07-stable
  
• d6cb4a2 does not appear in SCOPe 2.08