Lineage for d6cb4a1 (6cb4 A:46-225)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424671Species Canavalia ensiformis [TaxId:3823] [350078] (1 PDB entry)
  8. 2424672Domain d6cb4a1: 6cb4 A:46-225 [350079]
    automated match to d1uika1
    complexed with bez

Details for d6cb4a1

PDB Entry: 6cb4 (more details), 1.3 Å

PDB Description: high resolution structure of the hexagonal crystal form of the vicilin protein canavalin in complex with endogenous benzoic acid
PDB Compounds: (A:) canavalin

SCOPe Domain Sequences for d6cb4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cb4a1 b.82.1.0 (A:46-225) automated matches {Canavalia ensiformis [TaxId: 3823]}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd

SCOPe Domain Coordinates for d6cb4a1:

Click to download the PDB-style file with coordinates for d6cb4a1.
(The format of our PDB-style files is described here.)

Timeline for d6cb4a1:

  • d6cb4a1 is new in SCOPe 2.07-stable
  • d6cb4a1 does not appear in SCOPe 2.08

View in 3D
Domains from same chain:
(mouse over for more information)
d6cb4a2