Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (31 species) not a true protein |
Species Canavalia ensiformis [TaxId:3823] [350078] (1 PDB entry) |
Domain d6cb4a1: 6cb4 A:46-225 [350079] automated match to d1uika1 complexed with bez |
PDB Entry: 6cb4 (more details), 1.3 Å
SCOPe Domain Sequences for d6cb4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cb4a1 b.82.1.0 (A:46-225) automated matches {Canavalia ensiformis [TaxId: 3823]} nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmpkd
Timeline for d6cb4a1: